PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01077.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 399aa    MW: 44317.3 Da    PI: 4.343
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01077.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.51.9e-4761341129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtd elv +yLk+kv gkkl + ++i+e+diy++eP+dLp k  +k+++ +w+fF++r+kky+tg r+nrat+ gyWk
  Rsa1.0_01077.1_g00010.1   6 LAPGFRFHPTDVELVRYYLKRKVLGKKLLV-DAIAELDIYNFEPSDLPdKsYIKSGDLKWHFFCPREKKYSTGVRANRATACGYWK 90 
                              579************************999.89**************96347778888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              +tgk+++vl+ +ge+ g  ktLv++ g++p+ge+tdWvmheyrle
  Rsa1.0_01077.1_g00010.1  91 TTGKERDVLC-NGEVAGKIKTLVYHFGKSPRGERTDWVMHEYRLE 134
                              **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-563156IPR003441NAC domain
PROSITE profilePS5100551.9516156IPR003441NAC domain
PfamPF023651.3E-258133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MGKTQLAPGF RFHPTDVELV RYYLKRKVLG KKLLVDAIAE LDIYNFEPSD LPDKSYIKSG  60
DLKWHFFCPR EKKYSTGVRA NRATACGYWK TTGKERDVLC NGEVAGKIKT LVYHFGKSPR  120
GERTDWVMHE YRLEDKVLTQ KNVPQDTYVL CVLFKKDGPG PRNGAQYGAP FKDEDWSDEE  180
QDTGVRATNA PAVLQGETSL VVASSHVPDK DCFVGMIAES CVSDFLQATT TATGLPQLND  240
AANTPLSAAP LLDSNSTASL APPTLEAPNN DDDIYSMLDL FVDEDEYFRF SEFNNTEMRH  300
DPNVSAPICL GEGEDIFSEL PDFSNMQHNS MPRTPSFDLI ENSELYLELQ DLTAPLAPPQ  360
IGNASDSYLS YQGQFDFSTA ANDDDPYGFS ASMGQGPDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-43615615168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125756.10.0PREDICTED: NAC domain-containing protein 89-like
SwissprotQ9FY820.0NAC82_ARATH; NAC domain-containing protein 82
TrEMBLM4EIM50.0M4EIM5_BRARP; Uncharacterized protein
STRINGBra028640.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.41e-170NAC domain containing protein 82